PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG212100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 25815.3 Da    PI: 8.4843
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG212100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.42.9e-261059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         ri+n +nrqvtfskRr g++KKA EL +LCda+v +++fs  g+lye+ss
  Pavir.5KG212100.1.p 10 RIDNRTNRQVTFSKRRSGLMKKARELAILCDADVGLVVFSCAGRLYEFSS 59
                         9***********************************************96 PP

2K-box80.53.9e-27851711298
                K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          ++a+ +q e+a L+++++ Lq+++R+l+Ge+L+ L++++Lq L++q+e sl+++R+kK++ll e+i +l kk   lq+en +L+k++
  Pavir.5KG212100.1.p  85 SEAKFWQMEVATLRQQVQDLQNNNRKLMGEELSGLTIRDLQFLQSQIEMSLQSVRKKKEQLLAEEIMQLNKKGIVLQKENVELTKEV 171
                          6889*******************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.978161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-31278IPR002100Transcription factor, MADS-box
CDDcd002655.77E-41271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2485171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.9587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGKIAIQR IDNRTNRQVT FSKRRSGLMK KARELAILCD ADVGLVVFSC AGRLYEFSSS  60
SMKTVIERYQ EAREENNCPL LNPISEAKFW QMEVATLRQQ VQDLQNNNRK LMGEELSGLT  120
IRDLQFLQSQ IEMSLQSVRK KKEQLLAEEI MQLNKKGIVL QKENVELTKE VSIAHQHKIE  180
LQKKLSGEST SGDGDQASGS SNKVPGRSTA HDASEHVNLA LSIERDADE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-21176176Myocyte-specific enhancer factor 2B
1tqe_Q2e-21176176Myocyte-specific enhancer factor 2B
1tqe_R2e-21176176Myocyte-specific enhancer factor 2B
1tqe_S2e-21176176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967658.11e-140PREDICTED: MADS-box transcription factor 25-like
SwissprotQ84NC51e-105MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLJ3LWM61e-107J3LWM6_ORYBR; Uncharacterized protein
STRINGOB04G15510.11e-107(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.15e-78AGAMOUS-like 16